ELISA Recombinant Erwinia tasmaniensis UPF0299 membrane protein ETA_12980 (ETA_12980)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Erwinia tasmaniensis (strain DSM 17950 / Et1/99) Uniprot NO.:B2VIF5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRSFLHVIWQYLRAFFVIWLCLYAGRGVAWLLPIAIPASILGmLLLFILLSANILPLAWV KPGCNLLIRYMALLFVPISVGIMDHMDILSAQFAPIVISCAVGTLIVLMTTGMVAQRMDN RHSRRLEGKDE Protein Names:Recommended name: UPF0299 membrane protein ETA_12980 Gene Names:Ordered Locus Names:ETA_12980 Expression Region:1-131 Sequence Info:fµLl length protein