ELISA Recombinant Erwinia tasmaniensis UPF0299 membrane protein ETA_12980 (ETA_12980)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Erwinia tasmaniensis (strain DSM 17950 / Et1/99)
Uniprot NO.:B2VIF5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRSFLHVIWQYLRAFFVIWLCLYAGRGVAWLLPIAIPASILGmLLLFILLSANILPLAWV KPGCNLLIRYMALLFVPISVGIMDHMDILSAQFAPIVISCAVGTLIVLMTTGMVAQRMDN RHSRRLEGKDE
Protein Names:Recommended name: UPF0299 membrane protein ETA_12980
Gene Names:Ordered Locus Names:ETA_12980
Expression Region:1-131
Sequence Info:fµLl length protein