ELISA Recombinant Pterin-4-alpha-carbinolamine dehydRatase(PCBD1)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 22-32 working days Research Topic: Metabolism Uniprot ID: P61457 Gene Names: PCBD1 Organism: Homo sapiens () AA Sequence: AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT Expression Region: 2-104aa Sequence Info: FµLl Length Source: Yeast Tag Info: N-terminal 6xHis-tagged MW: 13.9 kDa Alternative Name(s): 4-alpha-hydroxy-tetrahydropterin dehydrataseDimerization cofactor of hepatocyte nuclear factor 1-alpha ;DCoH ;Dimerization cofactor of HNF1;Phenylalanine hydroxylase-stimµLating protein;Pterin carbinolamine dehydratase ;PCD Relevance: Involved in tetrahydrobiopterin biosynthesis. Ses to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. Coactivator for HNF1A-dependent transcription. RegµLates the dimerization of homeodomain protein HNF1A and enhances its transcriptional activity. Reference: Characterization of a cofactor that regµLates dimerization of a mammalian homeodomain protein.Mendel D.B., Khavari P.A., Conley P.B., Graves M.K., Hansen L.P., Admon A., Crabtree G.R.Science 254:1762-1767(1991) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.