Se rendre au contenu

ELISA Recombinant Carcinoembryonic antigen-related cell adhesion molecule 5(CEACAM5)

https://www.ucb-bioproducts.com/web/image/product.template/130709/image_1920?unique=4d171d3
Quantity:100µg. Other Quantitys are also available. For further information, please contact us. Research Areas:Cancer Uniprot ID:P06731 Gene Names:CEACAM5 Organism:Homo sapiens () AA Sequence:KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA Expression Region:35-685aa Sequence Info:FµLl length Source:Yeast Tag Info:N-terminal 6xHis-tagged MW:73.3 kDa Alternative Name(s):Carcinoembryonic antigen ?CEA? ?Meconium antigen 100? ?CD66e? Relevance: Reference: Purity:Greater than 90% as determined by SDS-PAGE. Form:Liquid or Lyophilized powder Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Function: Involvement in disease: SubcellµLar Location: Protein Families: Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link: STRING Database Link: OMIM Database Link: Lead Time Guidance:25-35 business days

848,80 € 848.8 EUR 848,80 €

848,80 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables