Se rendre au contenu

ELISA Recombinant Serine-arginine-rich splicing factor 9(SRSF9)

https://www.ucb-bioproducts.com/web/image/product.template/138683/image_1920?unique=18ea82b
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Transcription Uniprot ID: Q13242 Gene Names: SRSF9 Organism: Homo sapiens () AA Sequence: MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRGGWPRGGRNGPPTRRSDFRVLVSGLPPSGSWQDLKDHMREAGDVCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFRPY Expression Region: 1-221aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal GST-tagged MW: 52.5 kDa Alternative Name(s): Pre-mRNA-splicing factor SRp30CSplicing factor, arginine/serine-rich 9 Relevance: Plays a role in constitutive splicing and can modµLate the selection of alternative splice sites. Represses the splicing of MAPT/Tau exon 10 Reference: Identification and characterization of three members of the SR family of pre-mRNA splicing factors.Screaton G.R., Caceres J.F., Mayeda A., Bell M.V., Plebanski M., Jackson D.G., Bell J.I., Krainer A.R.EMBO J. 14:4336-4349(1995) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

709,00 € 709.0 EUR 709,00 €

709,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables