Se rendre au contenu

ELISA Recombinant Calcitonin gene-related peptide 2(CALCB)

https://www.ucb-bioproducts.com/web/image/product.template/130587/image_1920?unique=4d171d3
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Neuroscience Uniprot ID: P10092 Gene Names: CALCB Organism: Homo sapiens () AA Sequence: MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGRRRRDLQA Expression Region: 1-127aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal GST-tagged MW: 40.7 kDa Alternative Name(s): Beta-type CGRP Relevance: CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vascµLature. Its abundance in the CNS also points toward a neurotransmitter or neuromodµLator role. Reference: "Structure and expression of the calcitonin/CGRP genes." Steenbergh P.H., Hoeppener J.W.M., Zandberg J., Visser A., Lips C.J.M., Jansz H.S. FEBS Lett. 209:97-103(1986) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

709,00 € 709.0 EUR 709,00 €

709,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables