ELISA Recombinant Pseudomonas putida Cytochrome o ubiquinol oxidase subunit 3(cyoC)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pseudomonas putida (Arthrobacter siderocapsµLatus) Uniprot NO.:Q9WWR3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSSQVMHGAAHGHDHGHDDHHHDSGQMTVLGFWLYLMTDCILFASLFATYAVLSGSFAGG PSGHDIFQLDFVAVETLFLLLSSITFGFAmLKMFDGKKAGVLGWLAVTFLFGAGFIAMEI YEFHHLIAEGFGPQRSGFLSGFFALVGTHGLHVTAGLIWMAIMMYQINKHGITPTAKTRM SCLSLFWHFLDVVWICVFTVVYLLGVL Protein Names:Recommended name: Cytochrome o ubiquinol oxidase subunit 3 EC= 1.10.3.- Alternative name(s): Cytochrome o ubiquinol oxidase subunit III Gene Names:Name:cyoC Expression Region:1-207 Sequence Info:fµLl length protein