Se rendre au contenu

ELISA Recombinant Phosphatidate cytidylyltransferase 1(CDS1)

https://www.ucb-bioproducts.com/web/image/product.template/136993/image_1920?unique=f2aba11
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q92903 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLELRHRGSCPGPREAVSPPHREGEAAGGDHETESTSDKETDIDDRYGDLDSRTDSDIPE IPPSSDRTPEILKKALSGLSSRWKNWWIRGILTLTMISLFFLIIYMGSFmLmLLVLGIQV KCFHEIITIGYRVYHSYDLPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLI RYHRFISFALYLAGFCMFVLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMI WFLVPISSVICNDITAYLFGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFIAAYVLSK YQYFVCPVEYRSDVNSFVTECEPSELFQLQTYSLPPFLKAVLRQERVSLYPFQIHSIALS TFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRG PNPSKVLQQLLVLQPEQQLNIYKTLKTHLIEKGILQPTLKV Protein Names:Recommended name: Phosphatidate cytidylyltransferase 1 EC= 2.7.7.41 Alternative name(s): CDP-DAG synthase 1 CDP-DG synthase 1 CDP-diacylglycerol synthase 1 Short name= CDS 1 CDP-diglyceride pyrophosphorylase 1 CDP-dig Gene Names:Name:CDS1 Synonyms:CDS Expression Region:1-461 Sequence Info:fµLl length protein

1.822,00 € 1822.0 EUR 1.822,00 €

1.822,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables