Se rendre au contenu

ELISA Recombinant Cardiolipin synthase 2(cls2)

https://www.ucb-bioproducts.com/web/image/product.template/112650/image_1920?unique=7485b17
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bacillus anthracis Uniprot NO.:Q81TR2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKNTLKLIFFVLLLFALFVSLRMFIDVAFYSDVIGIKDVSILGIISILFTVSAFLIGCVI FLENRHPSKTLTWLIVLGIFPVFGFFAYLLFGQNFRRKRMFQKKALLDEQAFLQYKGHED YEERILRNHKHQELLFRLADRLGALNISFQTETRTLTNGDETFQAILDGLKRAKHHIHME YYIVRDDKLGTEIKDILIQKSKEGVVVRFLYDAVGSFKLSKSYIEELNDAGVEMIPFFPV RFPILNDKINYRNHRKIVIIDGNEGFVGGLNIGDEYLGKDKYFGFWRDTHLYLRGEAVQS LQLIFLQDWFYMTGEAVLAPEYLQAKAVEGEHWGGVQLVAGGPDNKWETIKHLYFAMIAS ARKSIWIATPYFIPDDDILSALKVAALAGIDVRLLMPSKPDKRTVFYASRSYFPELLDAG VKIYEYEKGFLHSKVVIVDSDLASIGTANMDMRSFHLNFEVNAFLYDTDSIRKLVQDFKD DLEESSEIHVDRFHKRRLHRRIVESTYRLLSPLL Protein Names:Recommended name: Cardiolipin synthase 2 Short name= CL synthase 2 EC= 2.7.8.- Gene Names:Name:cls2 Synonyms:cls-2 Ordered Locus Names:BA_1204, GBAA_1204, BAS1112 Expression Region:1-514 Sequence Info:fµLl length protein

1.878,00 € 1878.0 EUR 1.878,00 €

1.878,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables