ELISA Recombinant Bison bison Cytochrome c oxidase subunit 2(MT-CO2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bison bison (American bison) (Bos bison) Uniprot NO.:Q37416 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLmLTTKLTHTSTMDAQE VETIWTILPAIILILIALPSLRILYMMDEINNPFLTVKAMGHQWYWSYEYTDYEDLSFDS YMIPTSELKPGELRLLEVDNRVVLPMEMTIRmLVSSEDVLHSWAVPSLGLKTDAIPGRLN QTTLMSTRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASmL Protein Names:Recommended name: Cytochrome c oxidase subunit 2 Alternative name(s): Cytochrome c oxidase polypeptide II Gene Names:Name:MT-CO2 Synonyms:COII, COXII, MTCO2 Expression Region:1-227 Sequence Info:fµLl length protein