ELISA Recombinant Erwinia tasmaniensis Electron transport complex protein RnfG(rnfG)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Erwinia tasmaniensis (strain DSM 17950 / Et1/99) Uniprot NO.:B2VEQ5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLDAIRKNGVTLAVFAAITTGLTAVINAVTKPTIEHQTAVQQKILLDQVVPPELYNNRIQ DECYSVTDPALGNTNPHHLYLARKDDKPVAVALETTAPDGYSGNIQMIVGASFDGIVYGT RVVEHHETPGLGDKIELRISDWINSFNGKKVNGPSDGHFAVKKDGGDFDQFTGATITPRA VVNAVKRTTLYIETLPGQLSSLPTCGDANE Protein Names:Recommended name: Electron transport complex protein RnfG Gene Names:Name:rnfG Ordered Locus Names:ETA_17780 Expression Region:1-210 Sequence Info:fµLl length protein