ELISA Recombinant Arabidopsis thaliana ATP synthase subunit a, chloroplastic(atpI)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.:P56758 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNVLSCSINTLIKEGLYEISGVEVGQHFYWQIGGFQVHAQVLITSWVVIAILLGSAVLAI RNPQTIPTDGQNFFEFVLEFIRDVSKTQIGEEYGPWVPFIGTLFLFIFVSNWSGALLPWK IIQLPQGELAAPTNDINTTVALALLTSVAYFYAGLSKKGLGYFSKYIQPTPILLPINILE DFTKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAY IGESMEGHH Protein Names:Recommended name: ATP synthase subunit a, chloroplastic Alternative name(s): ATP synthase F0 sector subunit a F-ATPase subunit IV Gene Names:Name:atpI Ordered Locus Names:AtCg00150 Expression Region:1-249 Sequence Info:fµLl length protein