Se rendre au contenu

ELISA Recombinant Bacillus subtilis Uncharacterized protein ypdP(ypdP)

https://www.ucb-bioproducts.com/web/image/product.template/118707/image_1920?unique=5f2a55b
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bacillus subtilis (strain 168) Uniprot NO.:P54163 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MFNNSFWIFFAIIHFIIVLLFYKGFGKMGLFVWIGFATVCANLQVVKTVELFGLTATLGN VMYGTIFFATDVLNEKYGPAEARKAVWLGFSTLLTLTFVMQGVLLFEPASSDISQTALET IFGFLPRVALGSLLAFIFSQTLDVYVYSAIRRIFPSDRLLWLRNGGSTAVSQLFDTFIFT AVAFLGIYPADVWLHIFISTYLIKFAVSLISLPYAYAAKKMIPNDERSS Protein Names:Recommended name: Uncharacterized protein ypdP Gene Names:Name:ypdP Ordered Locus Names:BSU21980 Expression Region:1-229 Sequence Info:fµLl length protein

1.577,00 € 1577.0 EUR 1.577,00 €

1.577,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables