ELISA Recombinant Bacillus subtilis ComG operon protein 5(comGE)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bacillus subtilis (strain 168) Uniprot NO.:P25957 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:FSTIETMSALSLWLFVLLTVVPLWDKLMADEKMAESREIGYQMMNESISKYVMSGEGAAS KTITKNNHIYAMKWEEEGEYQNVCIKAAAYKEKSFCLSILQTEWLHAS Protein Names:Recommended name: ComG operon protein 5 Gene Names:Name:comGE Synonyms:comG5 Ordered Locus Names:BSU24690 Expression Region:8-115 Sequence Info:fµLl length protein