Se rendre au contenu

ELISA Recombinant Lysocardiolipin acyltransferase 1(LCLAT1)

https://www.ucb-bioproducts.com/web/image/product.template/134912/image_1920?unique=706639d
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q6UWP7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MHSRGREIVVLLNPWSINEAVSSYCTYFIKQDSKSFGIMVSWKGIYFILTLFWGSFFGSI FmLSPFLPLMFVNPSWYRWINNRLVATWLTLPVALLETMFGVKVIITGDAFVPGERSVII MNHRTRMDWMFLWNCLMRYSYLRLEKICLKASLKGVPGFGWAMQAAAYIFIHRKWKDDKS HFEDMIDYFCDIHEPLQLLIFPEGTDLTENSKSRSNAFAEKNGLQKYEYVLHPRTTGFTF VVDRLREGKNLDAVHDITVAYPHNIPQSEKHLLQGDFPREIHFHVHRYPIDTLPTSKEDL QLWCHKRWEEKEERLRSFYQGEKNFYFTGQSVIPPCKSELRVLVVKLLSILYWTLFSPAM CLLIYLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE Protein Names:Recommended name: Lysocardiolipin acyltransferase 1 EC= 2.3.1.- EC= 2.3.1.51 Alternative name(s): 1-acylglycerol-3-phosphate O-acyltransferase 8 Short name= 1-AGP acyltransferase 8 Short name= 1-AGPAT 8 Acyl-CoA:lys Gene Names:Name:LCLAT1 Synonyms:AGPAT8, ALCAT1, LYCAT ORF Names:UNQ1849/PRO3579 Expression Region:1-414 Sequence Info:fµLl length protein

1.772,00 € 1772.0 EUR 1.772,00 €

1.772,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables