Se rendre au contenu

ELISA Recombinant Lysocardiolipin acyltransferase 1(LCLAT1)

https://www.ucb-bioproducts.com/web/image/product.template/121974/image_1920?unique=706639d
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Gallus gallus (Chicken) Uniprot NO.:Q5F3X0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVSWKGIYFVVALFLGSFFGSIFmLGPFLPLMFISPAWYRWITDRIVATWLTLPVALLEM VFGAKVVVTGDGFIPGERSVIIMNHRTRMDWMFLWNCLLRYSYLRLEKICLKSSLKSIPG FGWAMQVAAFIFIQRKWEDDKSHFENmLHYFCDIHEPLQLLIFPEGTDLTANTKARSNDF AEKNGLRKYEYVLHPRTTGFTFVVECLREGNNLDAIHDITVAYPQNIPQTEKHLLNGNFP KEIHFHVQRYPIETVPTSKEELQLWCQKRWEEKEERLRRFYEGGKCFDETGQSIIPPCKS ELRVLAVKCISLLYWTVFPMGTFALLYLYSFARWYFAAMIIIFVAQQKIFGGLELIELAC HQYFKKQQKHDDTKMKKK Protein Names:Recommended name: Lysocardiolipin acyltransferase 1 EC= 2.3.1.- EC= 2.3.1.51 Gene Names:Name:LCLAT1 Synonyms:LYCAT ORF Names:RCJMB04_5b22 Expression Region:1-378 Sequence Info:fµLl length protein

1.734,00 € 1734.0 EUR 1.734,00 €

1.734,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables