Se rendre au contenu

ELISA Recombinant Cyberlindnera jadinii Squalene synthase(ERG9)

https://www.ucb-bioproducts.com/web/image/product.template/123303/image_1920?unique=c41145e
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Cyberlindnera jadinii (TorµLa yeast) (Pichia jadinii) Uniprot NO.:O74165 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGKLLQLALHPDELASIVQFKLFRKNENARNPATESAELIRCYELLNLTSRSFAAVIEEL HPELRNVIMVFYLVLRALDTVEVDMSIENSVKLPVLRQFHEKLDTKDWTFDGNSPNEKDR CVLVEFDRILGQYHELKPQYQKVIKEITEKMGNGMADYIENENFNSNGLLTIEDYDLYCY YVAGLVGDGLTQLIVLAKFGNSELSVNKQLFKSMGLFLQKTNIIRDYEEDQVDGRAFWPK EIWGKYANELSDFMKPENQSQGLWCISELVCNALDHVIDVLQYLALVEEQTSFNFCAIPQ VMAIATLELVFQNPQVLTQHVKIRKGTTVSLILESRTLEGCARIFRRYLRKIHHKSHPSD PNYLRLGITIGKIEQFLDGMYPHYVPKGITPQTTSIRTQVVKRLQLDEPMKRDIDEEILK TRILLLSLGVAVFGVVYGVVRII Protein Names:Recommended name: Squalene synthase Short name= SQS Short name= SS EC= 2.5.1.21 Alternative name(s): FPP:FPP farnesyltransferase Farnesyl-diphosphate farnesyltransferase Gene Names:Name:ERG9 Expression Region:1-443 Sequence Info:fµLl length protein

1.803,00 € 1803.0 EUR 1.803,00 €

1.803,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables