Skip to Content

ELISA Recombinant Protein BEX3(NGFRAP1)

https://www.ucb-bioproducts.com/web/image/product.template/137553/image_1920?unique=f2aba11
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Apoptosis Uniprot ID: Q00994 Gene Names: NGFRAP1 Organism: Homo sapiens () AA Sequence: MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP Expression Region: 1-111aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal GST-tagged MW: 40 kDa Alternative Name(s): Brain-expressed X-linked protein 3Nerve growth factor receptor-associated protein 1Ovarian granµLosa cell 13.0KDA protein HGR74p75NTR-associated cell death executor Relevance: May be a signaling adapter molecµLe involved in p75NTR-mediated apoptosis induced by NGF. Plays a role in zinc-triggered neuronal death May play an important role in the pathogenesis of neurogenetic diseases. Reference: A comparative gene expression profile of the whole eye from , mouse, and guinea pig.Zhou X., Wang W., Lu F., Hu S., Jiang L., Yan D., Zhang X., Yu X., Yu J., Qu J.Mol. Vis. 13:2214-2221(2007) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

709.00 € 709.0 EUR 709.00 €

709.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days