ELISA Recombinant Buchnera aphidicola subsp. Baizongia pistaciae High-affinity zinc uptake system membrane protein znuB(znuB)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) Uniprot NO.:Q89AJ1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MYKTFFFGWLAGVLLTTITGPLGLFIIWRRMSSFGDTLSHSSLLGISFAVLLNIHPFFMV IITILLFGmLIIWLNYTTVLSLDTILGIIGYSFLSLGMIIINSISNFQKNKLTNYLFGNL LEVTYIDIVILIISCVSILFVLVWYWDLmLLTTINSDLAKIDGVNVLKINSILIFLITLT IGIAIKFIGSLIAISLLIIPAATAQRFSTSPEKMAFFSVIIGIISITWGILMSVYYNLAI SPTIVFCSSIVFVISNLKKIL Protein Names:Recommended name: High-affinity zinc uptake system membrane protein znuB Gene Names:Name:znuB Ordered Locus Names:bbp_294 Expression Region:1-261 Sequence Info:fµLl length protein