ELISA Recombinant Kluyveromyces lactis Protein YOP1(YOP1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica) Uniprot NO.:Q6CP93 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MADYLKLFQDSLKGLDTKFAGNQILSRIEAQTKLPRSYVIVGLVAVYFLLIFINVGGIGE ILSNFVGFCIPTYYSLKALKTATSTDDTQLLTYWIVFSFLSVIEFWSKAILYWVPFYWFF KTVFLLYIAIPSFGGAQLVYTRLISPFSDKYLPIVEGKSGELAQKVEAAANNAKASGYSR Protein Names:Recommended name: Protein YOP1 Gene Names:Name:YOP1 Ordered Locus Names:KLLA0E06578g Expression Region:1-180 Sequence Info:fµLl length protein