Skip to Content

ELISA Recombinant Danio rerio Phosphatidylserine synthase 1(ptdss1)

https://www.ucb-bioproducts.com/web/image/product.template/123519/image_1920?unique=c41145e
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Danio rerio (Zebrafish) (Brachydanio rerio) Uniprot NO.:Q803C9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MATTFRSQTLSKDDVNYRMHFRMINEQQVEDITIQFFYKPHTISLLTVTVLSLMYFAFTR DDGDPDSNLRVGLILLVSFFLVISVLAFPNGPFTRPHPAIWRIVFGLSVLYFLFLVFIIF LNWDQVKALMFWLDPNLRYAKREADVMEYAVNCHVITWERILSHFDIFAFSHFWGWGMKA LLIRSYGLCWTISITWELTELFFMHLLPNFAECWWDQVILDILLCNGGGIWLGMTVCRFL EMRTYHWASIKDIHSTTGKIKRAVLQFTPASWTYVRWLDPKSSLQRVMGVYLFMIIWQLT ELNTFFLKHIFVFPACHALSWCRILFIGIITAPTVRQYYAYLTDTQCKRVGTQCWVFGAI AFLEALACIKFGQDLFSKTQILYVILWLVCLAFITFLCLYVMVWYAENYGPRQKSFSECE DSIYSEAGDSVTECKGEFEIDSTTSCSTRKRRDSGDSRTINGMEK Protein Names:Recommended name: Phosphatidylserine synthase 1 Short name= PSS-1 Short name= PtdSer synthase 1 EC= 2.7.8.29 Alternative name(s): Serine-exchange enzyme I Gene Names:Name:ptdss1 ORF Names:si:ch211-269k10, zgc:55906 Expression Region:1-465 Sequence Info:fµLl length protein

1,826.00 € 1826.0 EUR 1,826.00 €

1,826.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days