ELISA Recombinant Amblysomus hottentotus Aquaporin-2(AQP2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Amblysomus hottentotus (Hottentot golden mole) Uniprot NO.:O77697 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SIAFSRAVFSEFLATLLFVFFGLGSALNWPQALPSVLQIAMAFGLAIGTLVQTLGHISGA HINPAVTVACLVGCHVSFLRATFYVAAQLLGAVAGAALLHELTPPDIRG Protein Names:Recommended name: Aquaporin-2 Short name= AQP-2 Alternative name(s): ADH water channel Aquaporin-CD Short name= AQP-CD Collecting duct water channel protein WCH-CD Water channel protein for renal collecting duct Gene Names:Name:AQP2 Expression Region:1-109 Sequence Info:fµLl length protein