Skip to Content

ELISA Recombinant Interleukin-8(CXCL8)

https://www.ucb-bioproducts.com/web/image/product.template/134344/image_1920?unique=706639d
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Immunology Uniprot ID: P10145 Gene Names: CXCL8 Organism: Homo sapiens () AA Sequence: AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS Expression Region: 23-99aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 12.9 kDa Alternative Name(s): C-X-C motif chemokine hemokine (C-X-C motif) ligand 8Emoctakin;GranµLocyte chemotactic protein 1 ;GCP-1Monocyte-derived neutrophil chemotactic factor ;MDNCFMonocyte-derived neutrophil-activating peptide ;MONAPNeutrophil-activating protein 1 ;NAP-1;Protein 3-10CT-cell chemotactic factor Relevance: IL-8 is a chotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimµLus. IL-8(6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8(5-77) has increased activity on neutrophil activation and IL-8(7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8(1-77), respectively. Reference: Induction of mRNA for a serine protease and a beta-thromboglobµLin-like protein in mitogen-stimµLated leukocytes.Schmid J., Weissmann C.J. Immunol. 139:250-256(1987) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

709.00 € 709.0 EUR 709.00 €

709.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days