ELISA Recombinant Pseudomonas putida Ubiquinol oxidase subunit 2(cyoA)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pseudomonas putida (Arthrobacter siderocapsµLatus) Uniprot NO.:Q9WWR1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:CNWTLLDPKGQVGIEQKNLILIATGLmLLVVIPVIIMTVVFAWKYRASNKAATYTPDWSH STKIEAAVWIIPILIIIALGYFTYHSTHKLDPYRPLDSDVKPVQIDVVALDWKWLFIYPE QGIATVNKIVFPANTPVNFRVTSDAVMNSFFIPGLGGQIYAMAGMTTKLHLIANENGEFD GISANYSGAGFTGMKFKATATSQEDFDKWVAEVKQSPKKLDKAEYEALAKPSENNPVALY SEASPDQFQLIVDKYEGMNRGRPSHEEAGSKDLATTKGVESSMQPAAGAEE Protein Names:Recommended name: Ubiquinol oxidase subunit 2 EC= 1.10.3.- Alternative name(s): Cytochrome o subunit 2 Cytochrome o ubiquinol oxidase subunit 2 Oxidase BO(3) subunit 2 Ubiquinol oxidase polypeptide II Gene Names:Name:cyoA Expression Region:24-314 Sequence Info:fµLl length protein