ELISA Recombinant Prenylated Rab acceptor protein 1(RABAC1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q9UI14 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAAQKDQQKDAEAEGLSGTTLLPKLIPSGAGREWLERRRATIRPWSTFVDQQRFSRPRNL GELCQRLVRNVEYYQSNYVFVFLGLILYCVVTSPmLLVALAVFFGACYILYLRTLESKLV LFGREVSPAHQYALAGGISFPFFWLAGAGSAVFWVLGATLVVIGSHAAFHQIEAVDGEEL QMEPV Protein Names:Recommended name: Prenylated Rab acceptor protein 1 Alternative name(s): PRA1 family protein 1 Gene Names:Name:RABAC1 Synonyms:PRA1, PRAF1 Expression Region:1-185 Sequence Info:fµLl length protein