ELISA Recombinant Bacillus cereus Quinol oxidase subunit 2(qoxA)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bacillus cereus (strain ATCC 10987) Uniprot NO.:Q73DE0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:LAVLNPQGPVAKAQYDLIVWSFLLMSLIIAIVFILFTVILIRYREKPENMDYEPPEQHGN TLLEIIWTLVPVIIVIALSIPTVKATYASEEVPKESKHIKPVEIYVTSANWKWLFSYPEE KIETVNYLNIPAGVPIQFKLTSVGPMNAFWVPELGGMKYTMDGMIMDLYLQADKPGSYLG RSANFSGEGFTHMEFEVEAKTKEKYDKWVKEVQQTAPKLTEDKYNEIVKPGVVGRMTFSS HHLSYVDPKSLEYCDYNYYKNKK Protein Names:Recommended name: Quinol oxidase subunit 2 EC= 1.10.3.- Alternative name(s): Cytochrome aa(3) subunit 2 Quinol oxidase polypeptide II Gene Names:Name:qoxA Ordered Locus Names:BCE_0772 Expression Region:29-291 Sequence Info:fµLl length protein