Skip to Content

ELISA Recombinant coronavirus HKU1 Membrane protein(M)

https://www.ucb-bioproducts.com/web/image/product.template/131401/image_1920?unique=bf930ac
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species: coronavirus HKU1 (isolate N2) (HCoV-HKU1) Uniprot NO.:Q14EA7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNESIFPHWNSDQAITFLKEWNFSLGVILLLITIILQFGYTSRSMFVYLIKMIILWLMWP LTIILTIFNCFYALNNIFLGLSILFTIISIVIWILYFVNSIRLFIRTGSWWSFNPETNNL MCIDMKGKMYVRPVIEDYHTLTATVIRGHLYIQGVKLGTGYTLADLPVYVTVAKVQVLCT YKRAFLDKLDVNSGFAVFVKSKVGNYRLPSSKSSGMDTALLRA Protein Names:Recommended name: Membrane protein Short name= M protein Alternative name(s): E1 glycoprotein Matrix glycoprotein Membrane glycoprotein Gene Names:Name:M ORF Names:6 Expression Region:1-223 Sequence Info:fµLl length protein

1,570.00 € 1570.0 EUR 1,570.00 €

1,570.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days