Skip to Content

ELISA Recombinant Peroxisomal membrane protein 11B(PEX11B)

https://www.ucb-bioproducts.com/web/image/product.template/136922/image_1920?unique=f2aba11
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:O96011 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDAWVRFSAQSQARERLCRAAQYACSLLGHALQRHGASPELQKQIRQLESHLSLGRKLLR LGNSADALESAKRAVHLSDVVLRFCITVSHLNRALYFACDNVLWAGKSGLAPRVDQEKWA QRSFRYYLFSLIMNLSRDAYEIRLLMEQESSACSRRLKGSGGGVPGGSETGGLGGPGTPG GGLPQLALKLRLQVLLLARVLRGHPPLLLDVVRNACDLFIPLDKLGLWRCGPGIVGLCGL VSSILSILTLIYPWLRLKP Protein Names:Recommended name: Peroxisomal membrane protein 11B Alternative name(s): Peroxin-11B Peroxisomal biogenesis factor 11B Protein PEX11 homolog beta Short name= PEX11-beta Gene Names:Name:PEX11B Expression Region:1-259 Sequence Info:FµLl length protein

1,608.00 € 1608.0 EUR 1,608.00 €

1,608.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days