Se rendre au contenu

ELISA Recombinant Mouse Triggering receptor expressed on myeloid cells 2(Trem2),partial

https://www.ucb-bioproducts.com/web/image/product.template/146612/image_1920?unique=45d657d
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Immunology Uniprot ID: Q99NH8 Gene Names: Trem2 Organism: Mus muscµLus (Mouse) AA Sequence: LNTTVLQGMAGQSLRVSCTYDALKHWGRRKAWCRQLGEEGPCQRVVSTHGVWLLAFLKKRNGSTVIADDTLAGTVTITLKNLQAGDAGLYQCQSLRGREAEVLQKVLVEVLEDPLDDQDAGDLWVPEESSSFEGAQVEHSTSRNQETSFPPTS Expression Region: 19-171aa Sequence Info: ExtracellµLar Domain Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 20.8 kDa Alternative Name(s): Short name: TREM-2 Alternative name(s): Triggering receptor expressed on monocytes 2 Relevance: May have a role in chronic inflammations and may stimµLate production of constitutive rather than inflammatory chemokines and cytokines. Forms a receptor signaling complex with TYROBP and triggers activation of the immune responses in macrophages and dendritic cells. Reference: "Cloning and characterization of a novel mouse myeloid DAP12-associated receptor family."Daws M.R., Lanier L.L., Seaman W.E., Ryan J.C. Eur. J. Immunol. 31:783-791(2001) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

907,00 € 907.0 EUR 907,00 €

907,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables