ELISA Recombinant Arabidopsis thaliana E3 ubiquitin-protein ligase RMA1(RMA1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Arabidopsis thaliana (Mouse-ear cress) Uniprot NO.:O64425 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MALDQSFEDAALLGELYGEGAFCFKSKKPEPITVSVPSDDTDDSNFDCNICLDSVQEPVV TLCGHLFCWPCIHKWLDVQSFSTSDEYQRHRQCPVCKSKVSHSTLVPLYGRGRCTTQEEG KNSVPKRPVGPVYRLEMPNSPYASTDLRLSQRVHFNSPQEGYYPVSGVMSSNSLSYSAVL DPVMVMVGEMVATRLFGTRVMDRFAYPDTYNLAGTSGPRMRRRIMQADKSLGRIFFFFMC CVVLCLLLF Protein Names:Recommended name: E3 ubiquitin-protein ligase RMA1 EC= 6.3.2.- Alternative name(s): Protein RING membrane-anchor 1 Gene Names:Name:RMA1 Ordered Locus Names:At4g03510 ORF Names:F9H3.14 Expression Region:1-249 Sequence Info:fµLl length protein