Se rendre au contenu

ELISA Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1562 (AF_1562)

https://www.ucb-bioproducts.com/web/image/product.template/117478/image_1920?unique=7f7b80c
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Archaeoglobus fµLgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) Uniprot NO.:O28710 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVKMDRGRKVPEEQIIYADILYYGGLIGIIFMAITFAIYVSGTLPSLVKPEELTELWTHD THYYLEETGLPTGWGWINYVTYGDVLNFVALAFLAMITIICYLAIIPVLLKKKDIIYTIL AIAEVIILLLAASGLLQAGH Protein Names:Recommended name: Uncharacterized protein AF_1562 Gene Names:Ordered Locus Names:AF_1562 Expression Region:1-140 Sequence Info:fµLl length protein

1.483,00 € 1483.0 EUR 1.483,00 €

1.483,00 €

Not Available For Sale

Cette combinaison n'existe pas.

Conditions générales
Garantie satisfait ou remboursé de 30 jours
Expédition : 2-3 jours ouvrables