Skip to Content

ELISA Recombinant Dictyostelium discoideum SrfA-induced gene G protein(sigG)

https://www.ucb-bioproducts.com/web/image/product.template/124353/image_1920?unique=45d657d
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Dictyostelium discoideum (Slime mold) Uniprot NO.:Q54GL3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSTPTRTKKLIVSPTSVRKRVQNQNLTNTTYSTNSNSSRYRDSEENFLNRQQQELKQLHD QQLYELQELQEQQINEIEELSKQRSNTRIRNVFKVLITILVGSIIYGTYTNQFQPNPIEP FHLTEPIGQTWLHSLKDISTNWYHIWSDSFKDLARIKPLSESQTMPAGHRLHEKQILEKT LRRHQQEQDNNNNNKKTIENQMERMKRTDLERAIKEKTFFLDPTHYVNEEMIKQEIERQL KPHPGAPTPYNKDVYNSQNIYYPSSDAIPMVREKIENLENKVLDSVDEAIYKFGQKSKEL LHNIQEKKEQIKEKLNDEPSNIEKEFNSLIKEIEKANYNIFKDLKDNYGEPTIEKLNELR YKFNDAARESREVIKNKIESAQAIEQELAKNLKKPHADSNGHPKPYPHHHLLNQENQIDE NLIIV Protein Names:Recommended name: SrfA-induced gene G protein Gene Names:Name:sigG ORF Names:DDB_G0290071 Expression Region:1-425 Sequence Info:fµLl length protein

1,784.00 € 1784.0 EUR 1,784.00 €

1,784.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days