ELISA Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1562 (AF_1562)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Archaeoglobus fµLgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Uniprot NO.:O28710
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVKMDRGRKVPEEQIIYADILYYGGLIGIIFMAITFAIYVSGTLPSLVKPEELTELWTHD THYYLEETGLPTGWGWINYVTYGDVLNFVALAFLAMITIICYLAIIPVLLKKKDIIYTIL AIAEVIILLLAASGLLQAGH
Protein Names:Recommended name: Uncharacterized protein AF_1562
Gene Names:Ordered Locus Names:AF_1562
Expression Region:1-140
Sequence Info:fµLl length protein